PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 334aa    MW: 37537.9 Da    PI: 8.0674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00209genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l+++++++G g+W+++++  g+ R++k+c++rw +yl
       AA32G00209 14 KGLWSPEEDDKLLRYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.71.5e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
       AA32G00209  67 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129419.004961IPR017930Myb domain
SuperFamilySSF466891.57E-2912108IPR009057Homeodomain-like
SMARTSM007172.6E-131363IPR001005SANT/Myb domain
PfamPF002497.1E-161461IPR001005SANT/Myb domain
CDDcd001671.19E-111761No hitNo description
PROSITE profilePS5129425.50762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565116IPR009057Homeodomain-like
SMARTSM007179.1E-1366114IPR001005SANT/Myb domain
PfamPF002491.9E-1367111IPR001005SANT/Myb domain
CDDcd001674.23E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDDKLLRYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRMRG  120
IDPVTHKLLT EIETGTEDKT KPVEKPISAT INNNNRQSYL ETEGSSSTTT CSNHSIYTGN  180
FGFQRLSLET GSRIQTGSDL SVWFPQTGRN HHVETAIPSA VVIPGSMFGS GLTGYRSANL  240
GLIELENSFS TGPVITDQNY SNSTLYGNGN MNWGLTMDEQ ESQYMISNNN NNNNSLENHS  300
NSSLYSEIKS EINYSGMEAT NVGMWPQQHA YGHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760001e-156AF176000.2 Arabidopsis thaliana putative transcription factor (MYB55) mRNA, complete cds.
GenBankAY0545751e-156AY054575.1 Arabidopsis thaliana Unknown protein (At4g01680; T15B16.4) mRNA, complete cds.
GenBankBT0003521e-156BT000352.1 Arabidopsis thaliana Unknown protein (At4g01680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192077.10.0putative transcription factor MYB55
TrEMBLQ9M1180.0Q9M118_ARATH; Myb domain protein 55
STRINGAT4G01680.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.11e-178myb domain protein 55